Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1013211..1013984 | Replicon | chromosome |
Accession | NZ_CP118163 | ||
Organism | Staphylococcus hyicus strain SG-7 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | PTA87_RS05035 | Protein ID | WP_167693803.1 |
Coordinates | 1013829..1013984 (+) | Length | 52 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A0A8HNH4 |
Locus tag | PTA87_RS05030 | Protein ID | WP_039644857.1 |
Coordinates | 1013211..1013810 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTA87_RS05010 | 1009521..1010243 | + | 723 | WP_039644852.1 | amino acid ABC transporter ATP-binding protein | - |
PTA87_RS05015 | 1010408..1011535 | + | 1128 | WP_252547564.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PTA87_RS05020 | 1011538..1012008 | + | 471 | WP_039644854.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PTA87_RS05025 | 1012024..1013193 | + | 1170 | WP_274316401.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
PTA87_RS05030 | 1013211..1013810 | + | 600 | WP_039644857.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PTA87_RS05035 | 1013829..1013984 | + | 156 | WP_167693803.1 | SAS053 family protein | Toxin |
PTA87_RS05040 | 1014140..1014544 | + | 405 | WP_039644859.1 | hypothetical protein | - |
PTA87_RS05045 | 1014702..1016087 | + | 1386 | WP_274316402.1 | class II fumarate hydratase | - |
PTA87_RS05050 | 1016109..1017635 | + | 1527 | WP_274316403.1 | exopolyphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5989.31 Da Isoelectric Point: 3.9940
>T272915 WP_167693803.1 NZ_CP118163:1013829-1013984 [Staphylococcus hyicus]
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
MSEEKHIEHENEMVDNFDDLVQLGKEMEQISETNDQDKLNQSHDSEGRSNQ
Download Length: 156 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22363.41 Da Isoelectric Point: 6.0248
>AT272915 WP_039644857.1 NZ_CP118163:1013211-1013810 [Staphylococcus hyicus]
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
MAMNFKVFKDKDTAAIYAADIIRKQFNNNPTTIAGFHLNEEAAPVLDYLKRNVDDHAVDFSQIHILDYDKQTSYFKALGV
PEKQIHEIPEEDEVEKFIERKAKTKDNKGKLTLQVVSINNKGEFGIPVTNGLKPAREIFVVVTGSEKADVIKKLYEDNGN
TSFIPSSLKAHRMVNVILDEAAAQGLPDDVRAYFTSLYA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|