Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 875061..875585 | Replicon | chromosome |
| Accession | NZ_CP118163 | ||
| Organism | Staphylococcus hyicus strain SG-7 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0A8HRS0 |
| Locus tag | PTA87_RS04240 | Protein ID | WP_037567539.1 |
| Coordinates | 875232..875585 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PTA87_RS04235 | Protein ID | WP_107633598.1 |
| Coordinates | 875061..875231 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PTA87_RS04210 | 870856..871332 | + | 477 | WP_052257801.1 | PH domain-containing protein | - |
| PTA87_RS04215 | 871325..872815 | + | 1491 | WP_274316368.1 | PH domain-containing protein | - |
| PTA87_RS04220 | 872796..873311 | + | 516 | WP_274316369.1 | PH domain-containing protein | - |
| PTA87_RS04225 | 873379..873729 | + | 351 | WP_039644672.1 | holo-ACP synthase | - |
| PTA87_RS04230 | 873829..874977 | + | 1149 | WP_274316370.1 | alanine racemase | - |
| PTA87_RS04235 | 875061..875231 | + | 171 | WP_107633598.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PTA87_RS04240 | 875232..875585 | + | 354 | WP_037567539.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PTA87_RS04245 | 875662..876648 | + | 987 | WP_241961404.1 | PP2C family protein-serine/threonine phosphatase | - |
| PTA87_RS04250 | 876729..877055 | + | 327 | WP_039644676.1 | anti-sigma factor antagonist | - |
| PTA87_RS04255 | 877058..877537 | + | 480 | WP_039644678.1 | anti-sigma B factor RsbW | - |
| PTA87_RS04260 | 877512..878282 | + | 771 | WP_107633600.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13103.33 Da Isoelectric Point: 10.3729
>T272914 WP_037567539.1 NZ_CP118163:875232-875585 [Staphylococcus hyicus]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|