Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6219832..6220421 | Replicon | chromosome |
Accession | NZ_CP118156 | ||
Organism | Pseudomonas chlororaphis strain ATCC 15926 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A285IHJ3 |
Locus tag | PUP74_RS28125 | Protein ID | WP_062824477.1 |
Coordinates | 6220122..6220421 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP74_RS28120 | Protein ID | WP_007924096.1 |
Coordinates | 6219832..6220125 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP74_RS28095 (PUP74_28095) | 6215534..6215992 | + | 459 | WP_009045805.1 | GNAT family N-acetyltransferase | - |
PUP74_RS28100 (PUP74_28100) | 6216246..6216902 | + | 657 | WP_007924093.1 | DedA family protein | - |
PUP74_RS28105 (PUP74_28105) | 6216908..6217717 | + | 810 | WP_062824480.1 | zinc-dependent peptidase | - |
PUP74_RS28110 (PUP74_28110) | 6217982..6218509 | + | 528 | WP_009045807.1 | inorganic diphosphatase | - |
PUP74_RS28115 (PUP74_28115) | 6219324..6219716 | + | 393 | WP_274302033.1 | hypothetical protein | - |
PUP74_RS28120 (PUP74_28120) | 6219832..6220125 | - | 294 | WP_007924096.1 | putative addiction module antidote protein | Antitoxin |
PUP74_RS28125 (PUP74_28125) | 6220122..6220421 | - | 300 | WP_062824477.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP74_RS28130 (PUP74_28130) | 6220593..6221042 | + | 450 | WP_009045812.1 | DUF3828 domain-containing protein | - |
PUP74_RS28135 (PUP74_28135) | 6221067..6222077 | - | 1011 | WP_274302154.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP74_RS28140 (PUP74_28140) | 6222135..6222434 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
PUP74_RS28145 (PUP74_28145) | 6222502..6223590 | - | 1089 | WP_253366025.1 | copper-containing nitrite reductase | - |
PUP74_RS28150 (PUP74_28150) | 6223816..6224058 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP74_RS28155 (PUP74_28155) | 6224055..6224942 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11261.01 Da Isoelectric Point: 10.8652
>T272912 WP_062824477.1 NZ_CP118156:c6220421-6220122 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|