Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 4225768..4226287 | Replicon | chromosome |
| Accession | NZ_CP118156 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 15926 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1H3UB31 |
| Locus tag | PUP74_RS18975 | Protein ID | WP_007930524.1 |
| Coordinates | 4225768..4226049 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1H3UB71 |
| Locus tag | PUP74_RS18980 | Protein ID | WP_009044432.1 |
| Coordinates | 4226039..4226287 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP74_RS18955 (PUP74_18955) | 4221089..4221670 | - | 582 | WP_253364919.1 | hypothetical protein | - |
| PUP74_RS18960 (PUP74_18960) | 4221981..4222253 | + | 273 | WP_007927368.1 | hypothetical protein | - |
| PUP74_RS18965 (PUP74_18965) | 4223392..4223874 | + | 483 | WP_009044429.1 | acyl-CoA thioesterase | - |
| PUP74_RS18970 (PUP74_18970) | 4223927..4225576 | + | 1650 | WP_274300395.1 | FMN-binding glutamate synthase family protein | - |
| PUP74_RS18975 (PUP74_18975) | 4225768..4226049 | - | 282 | WP_007930524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP74_RS18980 (PUP74_18980) | 4226039..4226287 | - | 249 | WP_009044432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUP74_RS18985 (PUP74_18985) | 4226384..4227172 | - | 789 | WP_085534323.1 | helix-turn-helix transcriptional regulator | - |
| PUP74_RS18990 (PUP74_18990) | 4227257..4228255 | + | 999 | WP_114760888.1 | bile acid:sodium symporter family protein | - |
| PUP74_RS18995 (PUP74_18995) | 4228579..4230345 | + | 1767 | WP_274360187.1 | hypothetical protein | - |
| PUP74_RS19000 (PUP74_19000) | 4230418..4230879 | + | 462 | WP_009044436.1 | YccF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10890.73 Da Isoelectric Point: 10.6993
>T272911 WP_007930524.1 NZ_CP118156:c4226049-4225768 [Pseudomonas chlororaphis]
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H3UB31 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H3UB71 |