Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2533479..2534064 | Replicon | chromosome |
| Accession | NZ_CP118156 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 15926 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP74_RS11560 | Protein ID | WP_274301021.1 |
| Coordinates | 2533771..2534064 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A3G7H967 |
| Locus tag | PUP74_RS11555 | Protein ID | WP_062822914.1 |
| Coordinates | 2533479..2533769 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP74_RS11545 (PUP74_11545) | 2530994..2532376 | + | 1383 | WP_062822916.1 | efflux transporter outer membrane subunit | - |
| PUP74_RS11550 (PUP74_11550) | 2532495..2533082 | + | 588 | WP_007923530.1 | hypothetical protein | - |
| PUP74_RS11555 (PUP74_11555) | 2533479..2533769 | - | 291 | WP_062822914.1 | putative addiction module antidote protein | Antitoxin |
| PUP74_RS11560 (PUP74_11560) | 2533771..2534064 | - | 294 | WP_274301021.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP74_RS11565 (PUP74_11565) | 2534300..2535694 | - | 1395 | WP_274301022.1 | VOC family protein | - |
| PUP74_RS11570 (PUP74_11570) | 2535959..2537083 | + | 1125 | WP_274301023.1 | diguanylate cyclase | - |
| PUP74_RS11575 (PUP74_11575) | 2537177..2538421 | + | 1245 | WP_274301024.1 | M20/M25/M40 family metallo-hydrolase | - |
| PUP74_RS11580 (PUP74_11580) | 2538653..2539048 | + | 396 | WP_062822909.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10764.40 Da Isoelectric Point: 10.4234
>T272909 WP_274301021.1 NZ_CP118156:c2534064-2533771 [Pseudomonas chlororaphis]
MDYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|