Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1221961..1222499 | Replicon | chromosome |
Accession | NZ_CP118156 | ||
Organism | Pseudomonas chlororaphis strain ATCC 15926 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A285H8D2 |
Locus tag | PUP74_RS05400 | Protein ID | WP_009042149.1 |
Coordinates | 1222221..1222499 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP74_RS05395 | Protein ID | WP_009042148.1 |
Coordinates | 1221961..1222224 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP74_RS05380 (PUP74_05380) | 1217952..1220225 | - | 2274 | WP_085529818.1 | TonB-dependent siderophore receptor | - |
PUP74_RS05385 (PUP74_05385) | 1220431..1221111 | + | 681 | WP_085529819.1 | Fe2+-dependent dioxygenase | - |
PUP74_RS05390 (PUP74_05390) | 1221115..1221900 | + | 786 | WP_274301535.1 | tetratricopeptide repeat protein | - |
PUP74_RS05395 (PUP74_05395) | 1221961..1222224 | + | 264 | WP_009042148.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PUP74_RS05400 (PUP74_05400) | 1222221..1222499 | + | 279 | WP_009042149.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP74_RS05405 (PUP74_05405) | 1222574..1223737 | - | 1164 | WP_009042150.1 | type III PLP-dependent enzyme | - |
PUP74_RS05410 (PUP74_05410) | 1224291..1225448 | - | 1158 | WP_274301534.1 | ABC transporter ATP-binding protein | - |
PUP74_RS05415 (PUP74_05415) | 1225445..1226098 | - | 654 | WP_053259627.1 | ABC transporter permease | - |
PUP74_RS05420 (PUP74_05420) | 1226113..1227006 | - | 894 | WP_274301533.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10853.45 Da Isoelectric Point: 8.5409
>T272907 WP_009042149.1 NZ_CP118156:1222221-1222499 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|