Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 540805..541475 | Replicon | chromosome |
Accession | NZ_CP118156 | ||
Organism | Pseudomonas chlororaphis strain ATCC 15926 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP74_RS02420 | Protein ID | WP_123411912.1 |
Coordinates | 540805..541233 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N8BIH3 |
Locus tag | PUP74_RS02425 | Protein ID | WP_062823999.1 |
Coordinates | 541230..541475 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP74_RS02405 (PUP74_02405) | 535927..538185 | + | 2259 | WP_274301721.1 | TonB-dependent receptor | - |
PUP74_RS02410 (PUP74_02410) | 538232..539557 | + | 1326 | WP_009041689.1 | LLM class flavin-dependent oxidoreductase | - |
PUP74_RS02415 (PUP74_02415) | 539642..540679 | + | 1038 | WP_053259262.1 | L-glyceraldehyde 3-phosphate reductase | - |
PUP74_RS02420 (PUP74_02420) | 540805..541233 | - | 429 | WP_123411912.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PUP74_RS02425 (PUP74_02425) | 541230..541475 | - | 246 | WP_062823999.1 | hypothetical protein | Antitoxin |
PUP74_RS02430 (PUP74_02430) | 541603..542442 | - | 840 | WP_274301720.1 | taurine dioxygenase | - |
PUP74_RS02435 (PUP74_02435) | 542527..543366 | - | 840 | WP_009041694.1 | taurine ABC transporter permease TauC | - |
PUP74_RS02440 (PUP74_02440) | 543363..544157 | - | 795 | WP_085533376.1 | taurine ABC transporter ATP-binding subunit | - |
PUP74_RS02445 (PUP74_02445) | 544252..545229 | - | 978 | WP_009041696.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15853.46 Da Isoelectric Point: 5.4985
>T272905 WP_123411912.1 NZ_CP118156:c541233-540805 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGRRKQMLHASALAMFEEDFIERIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGRRKQMLHASALAMFEEDFIERIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|