Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2612310..2612929 | Replicon | chromosome |
Accession | NZ_CP118155 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17411 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3G7DMG3 |
Locus tag | PUP78_RS11875 | Protein ID | WP_009048155.1 |
Coordinates | 2612747..2612929 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A285IZU0 |
Locus tag | PUP78_RS11870 | Protein ID | WP_007923747.1 |
Coordinates | 2612310..2612711 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP78_RS11855 (PUP78_11855) | 2608380..2610269 | + | 1890 | WP_124304744.1 | PAS domain S-box protein | - |
PUP78_RS11860 (PUP78_11860) | 2610266..2610901 | + | 636 | WP_124304745.1 | response regulator transcription factor | - |
PUP78_RS11865 (PUP78_11865) | 2610995..2611744 | + | 750 | WP_124304746.1 | hypothetical protein | - |
PUP78_RS11870 (PUP78_11870) | 2612310..2612711 | - | 402 | WP_007923747.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP78_RS11875 (PUP78_11875) | 2612747..2612929 | - | 183 | WP_009048155.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP78_RS11880 (PUP78_11880) | 2613221..2613502 | - | 282 | WP_124304747.1 | hypothetical protein | - |
PUP78_RS11885 (PUP78_11885) | 2614146..2616305 | - | 2160 | WP_164486009.1 | AAA family ATPase | - |
PUP78_RS11890 (PUP78_11890) | 2616646..2617194 | - | 549 | WP_124304749.1 | YniB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6799.98 Da Isoelectric Point: 10.9678
>T272900 WP_009048155.1 NZ_CP118155:c2612929-2612747 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14579.54 Da Isoelectric Point: 4.6017
>AT272900 WP_007923747.1 NZ_CP118155:c2612711-2612310 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7DMG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285IZU0 |