Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1782577..1783199 | Replicon | chromosome |
Accession | NZ_CP118155 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17411 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP78_RS08125 | Protein ID | WP_106696706.1 |
Coordinates | 1783017..1783199 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP78_RS08120 | Protein ID | WP_106698998.1 |
Coordinates | 1782577..1782984 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP78_RS08100 (PUP78_08100) | 1777879..1778772 | + | 894 | WP_173678573.1 | LysR family transcriptional regulator | - |
PUP78_RS08105 (PUP78_08105) | 1779008..1780786 | + | 1779 | WP_124323664.1 | GGDEF and EAL domain-containing protein | - |
PUP78_RS08110 (PUP78_08110) | 1780820..1781734 | - | 915 | WP_124323665.1 | SGNH/GDSL hydrolase family protein | - |
PUP78_RS08115 (PUP78_08115) | 1781864..1782331 | - | 468 | WP_106696705.1 | GAF domain-containing protein | - |
PUP78_RS08120 (PUP78_08120) | 1782577..1782984 | - | 408 | WP_106698998.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP78_RS08125 (PUP78_08125) | 1783017..1783199 | - | 183 | WP_106696706.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP78_RS08135 (PUP78_08135) | 1783918..1784802 | - | 885 | WP_009047472.1 | alpha/beta hydrolase | - |
PUP78_RS08140 (PUP78_08140) | 1785154..1785846 | - | 693 | WP_025804997.1 | 16S rRNA pseudouridine(516) synthase | - |
PUP78_RS08145 (PUP78_08145) | 1785880..1786098 | - | 219 | WP_274346761.1 | cysteine-rich CWC family protein | - |
PUP78_RS08150 (PUP78_08150) | 1786106..1787593 | - | 1488 | WP_106696708.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6810.12 Da Isoelectric Point: 11.6709
>T272899 WP_106696706.1 NZ_CP118155:c1783199-1783017 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14657.65 Da Isoelectric Point: 4.4710
>AT272899 WP_106698998.1 NZ_CP118155:c1782984-1782577 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|