Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 545403..546073 | Replicon | chromosome |
Accession | NZ_CP118155 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17411 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP78_RS02435 | Protein ID | WP_124323278.1 |
Coordinates | 545403..545831 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
Locus tag | PUP78_RS02440 | Protein ID | WP_009046453.1 |
Coordinates | 545828..546073 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP78_RS02405 (PUP78_02405) | 540602..541090 | - | 489 | WP_124323274.1 | DoxX family membrane protein | - |
PUP78_RS02410 (PUP78_02410) | 541147..541887 | - | 741 | WP_124323275.1 | SDR family oxidoreductase | - |
PUP78_RS02415 (PUP78_02415) | 542017..542907 | + | 891 | WP_124323276.1 | LysR family transcriptional regulator | - |
PUP78_RS02420 (PUP78_02420) | 543032..543214 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | - |
PUP78_RS02425 (PUP78_02425) | 543244..543645 | + | 402 | WP_025808441.1 | type II toxin-antitoxin system HicB family antitoxin | - |
PUP78_RS02430 (PUP78_02430) | 544236..545273 | + | 1038 | WP_124323277.1 | L-glyceraldehyde 3-phosphate reductase | - |
PUP78_RS02435 (PUP78_02435) | 545403..545831 | - | 429 | WP_124323278.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PUP78_RS02440 (PUP78_02440) | 545828..546073 | - | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
PUP78_RS02445 (PUP78_02445) | 546213..547052 | - | 840 | WP_124323279.1 | taurine dioxygenase | - |
PUP78_RS02450 (PUP78_02450) | 547290..548129 | - | 840 | WP_124323280.1 | taurine ABC transporter permease TauC | - |
PUP78_RS02455 (PUP78_02455) | 548126..548920 | - | 795 | WP_023970012.1 | taurine ABC transporter ATP-binding subunit | - |
PUP78_RS02460 (PUP78_02460) | 549031..550008 | - | 978 | WP_124323281.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15862.37 Da Isoelectric Point: 5.4577
>T272897 WP_124323278.1 NZ_CP118155:c545831-545403 [Pseudomonas chlororaphis]
MIVLDTNVLSELMHPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEI
MIVLDTNVLSELMHPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEI
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|