Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 543032..543645 | Replicon | chromosome |
| Accession | NZ_CP118155 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17411 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285EYZ4 |
| Locus tag | PUP78_RS02420 | Protein ID | WP_009041685.1 |
| Coordinates | 543032..543214 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP78_RS02425 | Protein ID | WP_025808441.1 |
| Coordinates | 543244..543645 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP78_RS02395 (PUP78_02395) | 538206..540170 | + | 1965 | WP_164486059.1 | choline transporter BetT | - |
| PUP78_RS02400 (PUP78_02400) | 540291..540548 | - | 258 | WP_025808445.1 | hypothetical protein | - |
| PUP78_RS02405 (PUP78_02405) | 540602..541090 | - | 489 | WP_124323274.1 | DoxX family membrane protein | - |
| PUP78_RS02410 (PUP78_02410) | 541147..541887 | - | 741 | WP_124323275.1 | SDR family oxidoreductase | - |
| PUP78_RS02415 (PUP78_02415) | 542017..542907 | + | 891 | WP_124323276.1 | LysR family transcriptional regulator | - |
| PUP78_RS02420 (PUP78_02420) | 543032..543214 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP78_RS02425 (PUP78_02425) | 543244..543645 | + | 402 | WP_025808441.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP78_RS02430 (PUP78_02430) | 544236..545273 | + | 1038 | WP_124323277.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP78_RS02435 (PUP78_02435) | 545403..545831 | - | 429 | WP_124323278.1 | type II toxin-antitoxin system VapC family toxin | - |
| PUP78_RS02440 (PUP78_02440) | 545828..546073 | - | 246 | WP_009046453.1 | plasmid stabilization protein | - |
| PUP78_RS02445 (PUP78_02445) | 546213..547052 | - | 840 | WP_124323279.1 | taurine dioxygenase | - |
| PUP78_RS02450 (PUP78_02450) | 547290..548129 | - | 840 | WP_124323280.1 | taurine ABC transporter permease TauC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.08 Da Isoelectric Point: 10.4588
>T272896 WP_009041685.1 NZ_CP118155:543032-543214 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14568.38 Da Isoelectric Point: 4.9036
>AT272896 WP_025808441.1 NZ_CP118155:543244-543645 [Pseudomonas chlororaphis]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|