Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 3752453..3752969 | Replicon | chromosome |
| Accession | NZ_CP118154 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17414 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A285EY61 |
| Locus tag | PUP71_RS17100 | Protein ID | WP_009041601.1 |
| Coordinates | 3752453..3752734 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PUP71_RS17105 | Protein ID | WP_081002203.1 |
| Coordinates | 3752724..3752969 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP71_RS17080 (PUP71_17080) | 3748713..3749609 | - | 897 | WP_053259195.1 | HlyD family secretion protein | - |
| PUP71_RS17085 (PUP71_17085) | 3749606..3749815 | - | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
| PUP71_RS17090 (PUP71_17090) | 3749812..3751896 | - | 2085 | WP_053259194.1 | FUSC family protein | - |
| PUP71_RS17095 (PUP71_17095) | 3751893..3752321 | - | 429 | WP_053259193.1 | MarR family transcriptional regulator | - |
| PUP71_RS17100 (PUP71_17100) | 3752453..3752734 | - | 282 | WP_009041601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP71_RS17105 (PUP71_17105) | 3752724..3752969 | - | 246 | WP_081002203.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PUP71_RS17110 (PUP71_17110) | 3753032..3753277 | - | 246 | WP_009041599.1 | DUF2789 domain-containing protein | - |
| PUP71_RS17115 (PUP71_17115) | 3753415..3753876 | - | 462 | WP_053259191.1 | YbaK/EbsC family protein | - |
| PUP71_RS17120 (PUP71_17120) | 3754100..3755485 | + | 1386 | WP_053259190.1 | nodulation protein NfeD | - |
| PUP71_RS17125 (PUP71_17125) | 3755487..3756245 | + | 759 | WP_007932057.1 | slipin family protein | - |
| PUP71_RS17130 (PUP71_17130) | 3756211..3757215 | - | 1005 | WP_053259189.1 | aspartyl beta-hydroxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10879.81 Da Isoelectric Point: 10.5797
>T272894 WP_009041601.1 NZ_CP118154:c3752734-3752453 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|