Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2421471..2422093 | Replicon | chromosome |
| Accession | NZ_CP118154 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17414 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285HEJ8 |
| Locus tag | PUP71_RS11065 | Protein ID | WP_053259927.1 |
| Coordinates | 2421471..2421653 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A285HET1 |
| Locus tag | PUP71_RS11070 | Protein ID | WP_009042564.1 |
| Coordinates | 2421686..2422093 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP71_RS11045 (PUP71_11045) | 2417079..2417822 | + | 744 | WP_053259931.1 | hypothetical protein | - |
| PUP71_RS11050 (PUP71_11050) | 2417937..2418497 | - | 561 | Protein_2188 | HipA domain-containing protein | - |
| PUP71_RS11055 (PUP71_11055) | 2418621..2419580 | - | 960 | WP_053259929.1 | fimbrial protein | - |
| PUP71_RS11060 (PUP71_11060) | 2419691..2420407 | - | 717 | WP_053259928.1 | molecular chaperone | - |
| PUP71_RS11065 (PUP71_11065) | 2421471..2421653 | + | 183 | WP_053259927.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP71_RS11070 (PUP71_11070) | 2421686..2422093 | + | 408 | WP_009042564.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP71_RS11075 (PUP71_11075) | 2422299..2423213 | + | 915 | WP_053259926.1 | SGNH/GDSL hydrolase family protein | - |
| PUP71_RS11080 (PUP71_11080) | 2423247..2425025 | - | 1779 | WP_053259925.1 | sensor domain-containing phosphodiesterase | - |
| PUP71_RS11085 (PUP71_11085) | 2425263..2426153 | - | 891 | WP_053260051.1 | LysR family transcriptional regulator | - |
| PUP71_RS11090 (PUP71_11090) | 2426256..2426918 | + | 663 | WP_053259924.1 | NAD(P)-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6873.18 Da Isoelectric Point: 11.1084
>T272891 WP_053259927.1 NZ_CP118154:2421471-2421653 [Pseudomonas chlororaphis]
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14698.72 Da Isoelectric Point: 4.5911
>AT272891 WP_009042564.1 NZ_CP118154:2421686-2422093 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285HEJ8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285HET1 |