Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1546301..1546886 | Replicon | chromosome |
| Accession | NZ_CP118154 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17414 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP71_RS06805 | Protein ID | WP_053260473.1 |
| Coordinates | 1546301..1546594 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP71_RS06810 | Protein ID | WP_053260472.1 |
| Coordinates | 1546596..1546886 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP71_RS06785 (PUP71_06785) | 1541318..1541713 | - | 396 | WP_007932579.1 | carboxymuconolactone decarboxylase family protein | - |
| PUP71_RS06790 (PUP71_06790) | 1541946..1543190 | - | 1245 | WP_053260476.1 | M20/M25/M40 family metallo-hydrolase | - |
| PUP71_RS06795 (PUP71_06795) | 1543284..1544408 | - | 1125 | WP_053260475.1 | diguanylate cyclase | - |
| PUP71_RS06800 (PUP71_06800) | 1544672..1546066 | + | 1395 | WP_053260474.1 | VOC family protein | - |
| PUP71_RS06805 (PUP71_06805) | 1546301..1546594 | + | 294 | WP_053260473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP71_RS06810 (PUP71_06810) | 1546596..1546886 | + | 291 | WP_053260472.1 | putative addiction module antidote protein | Antitoxin |
| PUP71_RS06815 (PUP71_06815) | 1547283..1547870 | - | 588 | WP_053260471.1 | hypothetical protein | - |
| PUP71_RS06820 (PUP71_06820) | 1547989..1549371 | - | 1383 | WP_053260470.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10846.56 Da Isoelectric Point: 10.5107
>T272890 WP_053260473.1 NZ_CP118154:1546301-1546594 [Pseudomonas chlororaphis]
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|