Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2810675..2811260 | Replicon | chromosome |
Accession | NZ_CP118153 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17811 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP50_RS13185 | Protein ID | WP_274306290.1 |
Coordinates | 2810967..2811260 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A285IMN7 |
Locus tag | PUP50_RS13180 | Protein ID | WP_009043099.1 |
Coordinates | 2810675..2810965 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP50_RS13170 (PUP50_13170) | 2808189..2809571 | + | 1383 | WP_274306289.1 | efflux transporter outer membrane subunit | - |
PUP50_RS13175 (PUP50_13175) | 2809690..2810277 | + | 588 | WP_007923530.1 | hypothetical protein | - |
PUP50_RS13180 (PUP50_13180) | 2810675..2810965 | - | 291 | WP_009043099.1 | putative addiction module antidote protein | Antitoxin |
PUP50_RS13185 (PUP50_13185) | 2810967..2811260 | - | 294 | WP_274306290.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP50_RS13190 (PUP50_13190) | 2811496..2812890 | - | 1395 | WP_274306291.1 | VOC family protein | - |
PUP50_RS13195 (PUP50_13195) | 2813155..2814279 | + | 1125 | WP_274306292.1 | diguanylate cyclase | - |
PUP50_RS13200 (PUP50_13200) | 2814373..2815617 | + | 1245 | WP_053260476.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP50_RS13205 (PUP50_13205) | 2815850..2816245 | + | 396 | WP_007932579.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10706.31 Da Isoelectric Point: 10.0960
>T272888 WP_274306290.1 NZ_CP118153:c2811260-2810967 [Pseudomonas chlororaphis]
MDYEILQTAVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTAVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|