Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1870436..1871058 | Replicon | chromosome |
Accession | NZ_CP118153 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17811 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP50_RS08505 | Protein ID | WP_087089111.1 |
Coordinates | 1870876..1871058 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP50_RS08500 | Protein ID | WP_274305792.1 |
Coordinates | 1870436..1870843 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP50_RS08480 (PUP50_08480) | 1865742..1866632 | + | 891 | WP_274306755.1 | LysR family transcriptional regulator | - |
PUP50_RS08485 (PUP50_08485) | 1866870..1868648 | + | 1779 | WP_274305789.1 | sensor domain-containing phosphodiesterase | - |
PUP50_RS08490 (PUP50_08490) | 1868682..1869596 | - | 915 | WP_274305790.1 | SGNH/GDSL hydrolase family protein | - |
PUP50_RS08495 (PUP50_08495) | 1869726..1870193 | - | 468 | WP_274305791.1 | GAF domain-containing protein | - |
PUP50_RS08500 (PUP50_08500) | 1870436..1870843 | - | 408 | WP_274305792.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP50_RS08505 (PUP50_08505) | 1870876..1871058 | - | 183 | WP_087089111.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP50_RS08515 (PUP50_08515) | 1871780..1872664 | - | 885 | WP_101337082.1 | alpha/beta hydrolase | - |
PUP50_RS08520 (PUP50_08520) | 1873016..1873708 | - | 693 | WP_274305793.1 | 16S rRNA pseudouridine(516) synthase | - |
PUP50_RS08525 (PUP50_08525) | 1873742..1873960 | - | 219 | WP_274306756.1 | cysteine-rich CWC family protein | - |
PUP50_RS08530 (PUP50_08530) | 1873968..1875455 | - | 1488 | WP_274305794.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6851.13 Da Isoelectric Point: 11.3078
>T272886 WP_087089111.1 NZ_CP118153:c1871058-1870876 [Pseudomonas chlororaphis]
VDSRYLIGQIVADGWYLVRVRGSHHHFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VDSRYLIGQIVADGWYLVRVRGSHHHFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14683.75 Da Isoelectric Point: 4.7040
>AT272886 WP_274305792.1 NZ_CP118153:c1870843-1870436 [Pseudomonas chlororaphis]
MLYPIAISMGDDKHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPQYAGCTWAL
IDIDITKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDKHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPQYAGCTWAL
IDIDITKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|