Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 581994..582607 Replicon chromosome
Accession NZ_CP118153
Organism Pseudomonas chlororaphis strain ATCC 17811

Toxin (Protein)


Gene name hicA Uniprot ID A0A5M7CZT0
Locus tag PUP50_RS02590 Protein ID WP_007925285.1
Coordinates 581994..582176 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2N8BII0
Locus tag PUP50_RS02595 Protein ID WP_009041686.1
Coordinates 582206..582607 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUP50_RS02565 (PUP50_02565) 578135..578392 - 258 WP_053259255.1 hypothetical protein -
PUP50_RS02570 (PUP50_02570) 578632..579528 - 897 WP_102679893.1 SDR family oxidoreductase -
PUP50_RS02575 (PUP50_02575) 579558..580067 - 510 WP_053259256.1 DUF1097 domain-containing protein -
PUP50_RS02580 (PUP50_02580) 580101..580841 - 741 WP_274305237.1 SDR family oxidoreductase -
PUP50_RS02585 (PUP50_02585) 580980..581870 + 891 WP_274305238.1 LysR family transcriptional regulator -
PUP50_RS02590 (PUP50_02590) 581994..582176 + 183 WP_007925285.1 type II toxin-antitoxin system HicA family toxin Toxin
PUP50_RS02595 (PUP50_02595) 582206..582607 + 402 WP_009041686.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PUP50_RS02600 (PUP50_02600) 583192..584229 + 1038 WP_053259262.1 L-glyceraldehyde 3-phosphate reductase -
PUP50_RS02605 (PUP50_02605) 584379..584807 - 429 WP_274305239.1 type II toxin-antitoxin system VapC family toxin -
PUP50_RS02610 (PUP50_02610) 584804..585049 - 246 WP_009041692.1 plasmid stabilization protein -
PUP50_RS02615 (PUP50_02615) 585177..586016 - 840 WP_274305240.1 taurine dioxygenase -
PUP50_RS02620 (PUP50_02620) 586192..587031 - 840 WP_007925274.1 taurine ABC transporter permease TauC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6905.07 Da        Isoelectric Point: 10.3819

>T272885 WP_007925285.1 NZ_CP118153:581994-582176 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPKGTIHSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14629.48 Da        Isoelectric Point: 4.7569

>AT272885 WP_009041686.1 NZ_CP118153:582206-582607 [Pseudomonas chlororaphis]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAEAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGMI
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5M7CZT0

Antitoxin

Source ID Structure
AlphaFold DB A0A2N8BII0

References