Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2678311..2678981 | Replicon | chromosome |
| Accession | NZ_CP118152 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 336631 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PUP64_RS12285 | Protein ID | WP_081362979.1 |
| Coordinates | 2678553..2678981 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
| Locus tag | PUP64_RS12280 | Protein ID | WP_009046453.1 |
| Coordinates | 2678311..2678556 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP64_RS12260 (PUP64_12260) | 2674401..2675378 | + | 978 | WP_081362975.1 | taurine ABC transporter substrate-binding protein | - |
| PUP64_RS12265 (PUP64_12265) | 2675474..2676268 | + | 795 | WP_081362976.1 | taurine ABC transporter ATP-binding subunit | - |
| PUP64_RS12270 (PUP64_12270) | 2676265..2677104 | + | 840 | WP_081362977.1 | taurine ABC transporter permease TauC | - |
| PUP64_RS12275 (PUP64_12275) | 2677332..2678171 | + | 840 | WP_081362978.1 | taurine dioxygenase | - |
| PUP64_RS12280 (PUP64_12280) | 2678311..2678556 | + | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
| PUP64_RS12285 (PUP64_12285) | 2678553..2678981 | + | 429 | WP_081362979.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PUP64_RS12290 (PUP64_12290) | 2679110..2680147 | - | 1038 | WP_081362980.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP64_RS12295 (PUP64_12295) | 2680232..2681557 | - | 1326 | WP_081362981.1 | LLM class flavin-dependent oxidoreductase | - |
| PUP64_RS12300 (PUP64_12300) | 2681604..2683862 | - | 2259 | WP_081362982.1 | TonB-dependent receptor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15853.36 Da Isoelectric Point: 5.4927
>T272881 WP_081362979.1 NZ_CP118152:2678553-2678981 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASAVAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASAVAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|