Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5708799..5709388 | Replicon | chromosome |
| Accession | NZ_CP118151 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 9446 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP54_RS25970 | Protein ID | WP_007924097.1 |
| Coordinates | 5709089..5709388 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP54_RS25965 | Protein ID | WP_009045810.1 |
| Coordinates | 5708799..5709092 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP54_RS25940 (PUP54_25940) | 5704514..5704972 | + | 459 | WP_053262808.1 | GNAT family N-acetyltransferase | - |
| PUP54_RS25945 (PUP54_25945) | 5705226..5705882 | + | 657 | WP_007924093.1 | DedA family protein | - |
| PUP54_RS25950 (PUP54_25950) | 5705888..5706697 | + | 810 | WP_053262809.1 | zinc-dependent peptidase | - |
| PUP54_RS25955 (PUP54_25955) | 5706962..5707489 | + | 528 | WP_003228599.1 | inorganic diphosphatase | - |
| PUP54_RS25960 (PUP54_25960) | 5708297..5708683 | + | 387 | WP_053262810.1 | hypothetical protein | - |
| PUP54_RS25965 (PUP54_25965) | 5708799..5709092 | - | 294 | WP_009045810.1 | putative addiction module antidote protein | Antitoxin |
| PUP54_RS25970 (PUP54_25970) | 5709089..5709388 | - | 300 | WP_007924097.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP54_RS25975 (PUP54_25975) | 5709560..5710009 | + | 450 | WP_053262811.1 | DUF3828 domain-containing protein | - |
| PUP54_RS25980 (PUP54_25980) | 5710034..5711044 | - | 1011 | WP_173613368.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PUP54_RS25985 (PUP54_25985) | 5711102..5711401 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
| PUP54_RS25990 (PUP54_25990) | 5711468..5712556 | - | 1089 | WP_053262813.1 | copper-containing nitrite reductase | - |
| PUP54_RS25995 (PUP54_25995) | 5712783..5713025 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
| PUP54_RS26000 (PUP54_26000) | 5713022..5713909 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11326.08 Da Isoelectric Point: 10.6613
>T272878 WP_007924097.1 NZ_CP118151:c5709388-5709089 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|