Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2090592..2091177 | Replicon | chromosome |
Accession | NZ_CP118151 | ||
Organism | Pseudomonas chlororaphis strain ATCC 9446 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP54_RS09775 | Protein ID | WP_053260473.1 |
Coordinates | 2090884..2091177 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP54_RS09770 | Protein ID | WP_053260472.1 |
Coordinates | 2090592..2090882 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP54_RS09760 (PUP54_09760) | 2088107..2089489 | + | 1383 | WP_053260470.1 | efflux transporter outer membrane subunit | - |
PUP54_RS09765 (PUP54_09765) | 2089608..2090195 | + | 588 | WP_053260471.1 | hypothetical protein | - |
PUP54_RS09770 (PUP54_09770) | 2090592..2090882 | - | 291 | WP_053260472.1 | putative addiction module antidote protein | Antitoxin |
PUP54_RS09775 (PUP54_09775) | 2090884..2091177 | - | 294 | WP_053260473.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP54_RS09780 (PUP54_09780) | 2091412..2092806 | - | 1395 | WP_053260474.1 | VOC family protein | - |
PUP54_RS09785 (PUP54_09785) | 2093070..2094194 | + | 1125 | WP_053260475.1 | diguanylate cyclase | - |
PUP54_RS09790 (PUP54_09790) | 2094288..2095532 | + | 1245 | WP_053260476.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP54_RS09795 (PUP54_09795) | 2095765..2096160 | + | 396 | WP_007932579.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10846.56 Da Isoelectric Point: 10.5107
>T272877 WP_053260473.1 NZ_CP118151:c2091177-2090884 [Pseudomonas chlororaphis]
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
MNYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRLYFTVRGNTLIVLLLGGDK
STQPADICQARYLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|