Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 658242..658780 | Replicon | chromosome |
Accession | NZ_CP118151 | ||
Organism | Pseudomonas chlororaphis strain ATCC 9446 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A285H8D2 |
Locus tag | PUP54_RS02860 | Protein ID | WP_009042149.1 |
Coordinates | 658502..658780 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP54_RS02855 | Protein ID | WP_053259626.1 |
Coordinates | 658242..658505 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP54_RS02840 (PUP54_02840) | 654231..656504 | - | 2274 | WP_053259624.1 | TonB-dependent siderophore receptor | - |
PUP54_RS02845 (PUP54_02845) | 656711..657391 | + | 681 | WP_009042146.1 | Fe2+-dependent dioxygenase | - |
PUP54_RS02850 (PUP54_02850) | 657395..658180 | + | 786 | WP_053259625.1 | tetratricopeptide repeat protein | - |
PUP54_RS02855 (PUP54_02855) | 658242..658505 | + | 264 | WP_053259626.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PUP54_RS02860 (PUP54_02860) | 658502..658780 | + | 279 | WP_009042149.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP54_RS02865 (PUP54_02865) | 658855..660018 | - | 1164 | WP_009042150.1 | type III PLP-dependent enzyme | - |
PUP54_RS02870 (PUP54_02870) | 660718..661875 | - | 1158 | WP_007923834.1 | ABC transporter ATP-binding protein | - |
PUP54_RS02875 (PUP54_02875) | 661872..662525 | - | 654 | WP_053259627.1 | ABC transporter permease | - |
PUP54_RS02880 (PUP54_02880) | 662540..663433 | - | 894 | WP_053259628.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10853.45 Da Isoelectric Point: 8.5409
>T272875 WP_009042149.1 NZ_CP118151:658502-658780 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|