Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6504966..6505555 | Replicon | chromosome |
Accession | NZ_CP118150 | ||
Organism | Pseudomonas chlororaphis strain DSM 21509 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP49_RS29375 | Protein ID | WP_016702674.1 |
Coordinates | 6505256..6505555 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP49_RS29370 | Protein ID | WP_053281098.1 |
Coordinates | 6504966..6505259 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP49_RS29345 (PUP49_29345) | 6500601..6501329 | + | 729 | WP_053281093.1 | ABC transporter permease | - |
PUP49_RS29350 (PUP49_29350) | 6501326..6502036 | + | 711 | WP_053281094.1 | ABC transporter permease | - |
PUP49_RS29355 (PUP49_29355) | 6502053..6502817 | + | 765 | WP_053281095.1 | ATP-binding cassette domain-containing protein | - |
PUP49_RS29360 (PUP49_29360) | 6503204..6503596 | + | 393 | WP_053281096.1 | DUF3077 domain-containing protein | - |
PUP49_RS29365 (PUP49_29365) | 6503797..6504960 | + | 1164 | WP_053281097.1 | GGDEF domain-containing protein | - |
PUP49_RS29370 (PUP49_29370) | 6504966..6505259 | - | 294 | WP_053281098.1 | putative addiction module antidote protein | Antitoxin |
PUP49_RS29375 (PUP49_29375) | 6505256..6505555 | - | 300 | WP_016702674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP49_RS29380 (PUP49_29380) | 6505728..6506177 | + | 450 | WP_053281099.1 | DUF3828 domain-containing protein | - |
PUP49_RS29385 (PUP49_29385) | 6506202..6507212 | - | 1011 | WP_172833187.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP49_RS29390 (PUP49_29390) | 6507268..6507567 | - | 300 | WP_053281101.1 | helix-turn-helix transcriptional regulator | - |
PUP49_RS29395 (PUP49_29395) | 6507634..6508722 | - | 1089 | WP_053281102.1 | copper-containing nitrite reductase | - |
PUP49_RS29400 (PUP49_29400) | 6508950..6509192 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP49_RS29405 (PUP49_29405) | 6509189..6510076 | + | 888 | WP_053281103.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11221.93 Da Isoelectric Point: 10.6086
>T272874 WP_016702674.1 NZ_CP118150:c6505555-6505256 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|