Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2603855..2604440 | Replicon | chromosome |
| Accession | NZ_CP118150 | ||
| Organism | Pseudomonas chlororaphis strain DSM 21509 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP49_RS12045 | Protein ID | WP_053278359.1 |
| Coordinates | 2604147..2604440 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP49_RS12040 | Protein ID | WP_053278358.1 |
| Coordinates | 2603855..2604145 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP49_RS12025 (PUP49_12025) | 2599180..2601660 | + | 2481 | WP_053278594.1 | FtsX-like permease family protein | - |
| PUP49_RS12030 (PUP49_12030) | 2601650..2602726 | + | 1077 | WP_053278356.1 | lipocalin-like domain-containing protein | - |
| PUP49_RS12035 (PUP49_12035) | 2602854..2603441 | + | 588 | WP_053278357.1 | hypothetical protein | - |
| PUP49_RS12040 (PUP49_12040) | 2603855..2604145 | - | 291 | WP_053278358.1 | putative addiction module antidote protein | Antitoxin |
| PUP49_RS12045 (PUP49_12045) | 2604147..2604440 | - | 294 | WP_053278359.1 | addiction module antitoxin RelB | Toxin |
| PUP49_RS12050 (PUP49_12050) | 2604676..2606070 | - | 1395 | WP_053278360.1 | VOC family protein | - |
| PUP49_RS12055 (PUP49_12055) | 2606333..2607457 | + | 1125 | WP_053278361.1 | diguanylate cyclase | - |
| PUP49_RS12060 (PUP49_12060) | 2607551..2608795 | + | 1245 | WP_053278362.1 | M20/M25/M40 family metallo-hydrolase | - |
| PUP49_RS12065 (PUP49_12065) | 2609003..2609401 | + | 399 | WP_053278363.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10812.46 Da Isoelectric Point: 10.7340
>T272872 WP_053278359.1 NZ_CP118150:c2604440-2604147 [Pseudomonas chlororaphis]
MDYEIQQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSQMRVNMGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEIQQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSQMRVNMGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|