Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2590584..2591203 | Replicon | chromosome |
Accession | NZ_CP118150 | ||
Organism | Pseudomonas chlororaphis strain DSM 21509 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP49_RS11975 | Protein ID | WP_053278351.1 |
Coordinates | 2591021..2591203 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP49_RS11970 | Protein ID | WP_053278311.1 |
Coordinates | 2590584..2590985 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP49_RS11955 (PUP49_11955) | 2586769..2588658 | + | 1890 | WP_053278308.1 | PAS domain S-box protein | - |
PUP49_RS11960 (PUP49_11960) | 2588655..2589290 | + | 636 | WP_053278309.1 | response regulator transcription factor | - |
PUP49_RS11965 (PUP49_11965) | 2589383..2590132 | + | 750 | WP_053278310.1 | hypothetical protein | - |
PUP49_RS11970 (PUP49_11970) | 2590584..2590985 | - | 402 | WP_053278311.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP49_RS11975 (PUP49_11975) | 2591021..2591203 | - | 183 | WP_053278351.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP49_RS11980 (PUP49_11980) | 2591581..2591862 | - | 282 | WP_053278312.1 | hypothetical protein | - |
PUP49_RS11985 (PUP49_11985) | 2592280..2592636 | - | 357 | WP_053278313.1 | hypothetical protein | - |
PUP49_RS11990 (PUP49_11990) | 2592621..2592986 | - | 366 | Protein_2357 | hypothetical protein | - |
PUP49_RS11995 (PUP49_11995) | 2593145..2593426 | - | 282 | WP_053278315.1 | hypothetical protein | - |
PUP49_RS12000 (PUP49_12000) | 2594141..2595433 | + | 1293 | WP_164487001.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2584965..2596359 | 11394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6799.98 Da Isoelectric Point: 10.9678
>T272871 WP_053278351.1 NZ_CP118150:c2591203-2591021 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLL
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLL
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14591.59 Da Isoelectric Point: 4.6017
>AT272871 WP_053278311.1 NZ_CP118150:c2590985-2590584 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|