Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1804876..1805498 | Replicon | chromosome |
Accession | NZ_CP118150 | ||
Organism | Pseudomonas chlororaphis strain DSM 21509 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP49_RS08185 | Protein ID | WP_053277798.1 |
Coordinates | 1805316..1805498 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP49_RS08180 | Protein ID | WP_053277797.1 |
Coordinates | 1804876..1805283 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP49_RS08160 (PUP49_08160) | 1800236..1801126 | + | 891 | WP_053277793.1 | LysR family transcriptional regulator | - |
PUP49_RS08165 (PUP49_08165) | 1801363..1803141 | + | 1779 | WP_053277794.1 | GGDEF and EAL domain-containing protein | - |
PUP49_RS08170 (PUP49_08170) | 1803175..1804089 | - | 915 | WP_053277795.1 | SGNH/GDSL hydrolase family protein | - |
PUP49_RS08175 (PUP49_08175) | 1804219..1804686 | - | 468 | WP_053277796.1 | GAF domain-containing protein | - |
PUP49_RS08180 (PUP49_08180) | 1804876..1805283 | - | 408 | WP_053277797.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP49_RS08185 (PUP49_08185) | 1805316..1805498 | - | 183 | WP_053277798.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP49_RS08190 (PUP49_08190) | 1806564..1807280 | + | 717 | WP_053277799.1 | molecular chaperone | - |
PUP49_RS08195 (PUP49_08195) | 1807388..1808359 | + | 972 | WP_053277800.1 | fimbrial protein | - |
PUP49_RS08200 (PUP49_08200) | 1808528..1809132 | - | 605 | Protein_1617 | Arm DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6770.10 Da Isoelectric Point: 11.6709
>T272870 WP_053277798.1 NZ_CP118150:c1805498-1805316 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14594.56 Da Isoelectric Point: 4.3638
>AT272870 WP_053277797.1 NZ_CP118150:c1805283-1804876 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|