Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 556746..557359 | Replicon | chromosome |
| Accession | NZ_CP118150 | ||
| Organism | Pseudomonas chlororaphis strain DSM 21509 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285EYZ4 |
| Locus tag | PUP49_RS02500 | Protein ID | WP_009041685.1 |
| Coordinates | 556746..556928 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP49_RS02505 | Protein ID | WP_053277001.1 |
| Coordinates | 556958..557359 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP49_RS02480 (PUP49_02480) | 552293..554257 | + | 1965 | WP_164487030.1 | choline transporter BetT | - |
| PUP49_RS02485 (PUP49_02485) | 554416..554673 | - | 258 | WP_053276984.1 | hypothetical protein | - |
| PUP49_RS02490 (PUP49_02490) | 554853..555593 | - | 741 | WP_053276985.1 | SDR family oxidoreductase | - |
| PUP49_RS02495 (PUP49_02495) | 555731..556621 | + | 891 | WP_053276986.1 | LysR family transcriptional regulator | - |
| PUP49_RS02500 (PUP49_02500) | 556746..556928 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP49_RS02505 (PUP49_02505) | 556958..557359 | + | 402 | WP_053277001.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP49_RS02510 (PUP49_02510) | 557382..557798 | - | 417 | WP_124345253.1 | hypothetical protein | - |
| PUP49_RS02515 (PUP49_02515) | 557947..558984 | + | 1038 | WP_053276987.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP49_RS02520 (PUP49_02520) | 559164..559391 | - | 228 | WP_081001409.1 | hypothetical protein | - |
| PUP49_RS02525 (PUP49_02525) | 559488..560327 | - | 840 | WP_053276989.1 | taurine dioxygenase | - |
| PUP49_RS02530 (PUP49_02530) | 560412..561251 | - | 840 | WP_053276990.1 | taurine ABC transporter permease TauC | - |
| PUP49_RS02535 (PUP49_02535) | 561248..562042 | - | 795 | WP_053276991.1 | taurine ABC transporter ATP-binding subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.08 Da Isoelectric Point: 10.4588
>T272869 WP_009041685.1 NZ_CP118150:556746-556928 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14582.41 Da Isoelectric Point: 4.9133
>AT272869 WP_053277001.1 NZ_CP118150:556958-557359 [Pseudomonas chlororaphis]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVV
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|