Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HTH_37(antitoxin) |
| Location | 6590510..6591150 | Replicon | chromosome |
| Accession | NZ_CP118149 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 60037 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285GR45 |
| Locus tag | PUP59_RS30055 | Protein ID | WP_028681531.1 |
| Coordinates | 6590510..6590692 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A554PIE8 |
| Locus tag | PUP59_RS30060 | Protein ID | WP_041984783.1 |
| Coordinates | 6590725..6591150 (+) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP59_RS30025 (PUP59_30025) | 6585829..6586536 | + | 708 | WP_041984770.1 | hypothetical protein | - |
| PUP59_RS30030 (PUP59_30030) | 6586533..6587456 | + | 924 | WP_041984773.1 | hypothetical protein | - |
| PUP59_RS30035 (PUP59_30035) | 6587453..6588001 | + | 549 | WP_041984775.1 | hypothetical protein | - |
| PUP59_RS30040 (PUP59_30040) | 6587998..6588702 | + | 705 | WP_041984777.1 | hypothetical protein | - |
| PUP59_RS30045 (PUP59_30045) | 6588675..6589646 | + | 972 | WP_041984780.1 | hypothetical protein | - |
| PUP59_RS30050 (PUP59_30050) | 6589643..6590284 | - | 642 | WP_041985169.1 | hypothetical protein | - |
| PUP59_RS30055 (PUP59_30055) | 6590510..6590692 | + | 183 | WP_028681531.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP59_RS30060 (PUP59_30060) | 6590725..6591150 | + | 426 | WP_041984783.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP59_RS30065 (PUP59_30065) | 6591327..6591974 | - | 648 | WP_124355757.1 | hypothetical protein | - |
| PUP59_RS30070 (PUP59_30070) | 6592816..6593025 | + | 210 | WP_124355758.1 | hypothetical protein | - |
| PUP59_RS30075 (PUP59_30075) | 6594262..6595065 | + | 804 | WP_080768765.1 | lipopolysaccharide biosynthesis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 6540858..6593648 | 52790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6764.83 Da Isoelectric Point: 10.7304
>T272868 WP_028681531.1 NZ_CP118149:6590510-6590692 [Pseudomonas chlororaphis]
MKYSEFRRWLKAQGAEFQPGKGSHFKVTLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
MKYSEFRRWLKAQGAEFQPGKGSHFKVTLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15470.58 Da Isoelectric Point: 4.4313
>AT272868 WP_041984783.1 NZ_CP118149:6590725-6591150 [Pseudomonas chlororaphis]
MFKYALEIHEEPGTVWLSCEEIPEFHAAGDTVGEALDSVLDALETALSIYVDERRPIPSGNAEAQAGHVLLCLPALTAAK
VALWNAVLDEGTTKAELARRLGIQRPQVDRLLDFLHDSKIENVERALQELGRRISITVEAA
MFKYALEIHEEPGTVWLSCEEIPEFHAAGDTVGEALDSVLDALETALSIYVDERRPIPSGNAEAQAGHVLLCLPALTAAK
VALWNAVLDEGTTKAELARRLGIQRPQVDRLLDFLHDSKIENVERALQELGRRISITVEAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285GR45 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554PIE8 |