Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6411127..6411716 | Replicon | chromosome |
Accession | NZ_CP118149 | ||
Organism | Pseudomonas chlororaphis strain NCCB 60037 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A554PHZ9 |
Locus tag | PUP59_RS29105 | Protein ID | WP_041987451.1 |
Coordinates | 6411417..6411716 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP59_RS29100 | Protein ID | WP_041987449.1 |
Coordinates | 6411127..6411420 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP59_RS29080 (PUP59_29080) | 6406668..6407831 | - | 1164 | WP_041987444.1 | acyltransferase | - |
PUP59_RS29085 (PUP59_29085) | 6408026..6409216 | - | 1191 | WP_041987447.1 | serine hydrolase domain-containing protein | - |
PUP59_RS29090 (PUP59_29090) | 6409343..6410230 | + | 888 | WP_009051074.1 | LysR family transcriptional regulator | - |
PUP59_RS29095 (PUP59_29095) | 6410602..6410994 | + | 393 | WP_009051075.1 | hypothetical protein | - |
PUP59_RS29100 (PUP59_29100) | 6411127..6411420 | - | 294 | WP_041987449.1 | putative addiction module antidote protein | Antitoxin |
PUP59_RS29105 (PUP59_29105) | 6411417..6411716 | - | 300 | WP_041987451.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP59_RS29110 (PUP59_29110) | 6411887..6412336 | + | 450 | WP_041987453.1 | DUF3828 domain-containing protein | - |
PUP59_RS29115 (PUP59_29115) | 6412361..6413371 | - | 1011 | WP_172833408.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP59_RS29120 (PUP59_29120) | 6413429..6413728 | - | 300 | WP_009051080.1 | helix-turn-helix transcriptional regulator | - |
PUP59_RS29125 (PUP59_29125) | 6413792..6414883 | - | 1092 | WP_041987461.1 | copper-containing nitrite reductase | - |
PUP59_RS29130 (PUP59_29130) | 6415109..6415351 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP59_RS29135 (PUP59_29135) | 6415348..6416235 | + | 888 | WP_009051083.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11231.97 Da Isoelectric Point: 10.6086
>T272867 WP_041987451.1 NZ_CP118149:c6411716-6411417 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|