Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2598371..2598975 | Replicon | chromosome |
| Accession | NZ_CP118149 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 60037 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PUP59_RS11750 | Protein ID | WP_041988418.1 |
| Coordinates | 2598808..2598975 (-) | Length | 56 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A554PQR3 |
| Locus tag | PUP59_RS11745 | Protein ID | WP_041988420.1 |
| Coordinates | 2598371..2598772 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP59_RS11730 (PUP59_11730) | 2594254..2596143 | + | 1890 | WP_041988426.1 | PAS domain S-box protein | - |
| PUP59_RS11735 (PUP59_11735) | 2596140..2596775 | + | 636 | WP_023968669.1 | response regulator transcription factor | - |
| PUP59_RS11740 (PUP59_11740) | 2596917..2597633 | + | 717 | WP_231999294.1 | hypothetical protein | - |
| PUP59_RS11745 (PUP59_11745) | 2598371..2598772 | - | 402 | WP_041988420.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP59_RS11750 (PUP59_11750) | 2598808..2598975 | - | 168 | WP_041988418.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP59_RS11755 (PUP59_11755) | 2599355..2599636 | - | 282 | WP_041988415.1 | hypothetical protein | - |
| PUP59_RS11760 (PUP59_11760) | 2600329..2601654 | + | 1326 | WP_041988412.1 | hypothetical protein | - |
| PUP59_RS11765 (PUP59_11765) | 2601802..2602182 | - | 381 | WP_124355740.1 | hypothetical protein | - |
| PUP59_RS11770 (PUP59_11770) | 2603043..2603591 | - | 549 | WP_041988409.1 | YniB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2592449..2605613 | 13164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 56 a.a. Molecular weight: 6219.35 Da Isoelectric Point: 10.6778
>T272865 WP_041988418.1 NZ_CP118149:c2598975-2598808 [Pseudomonas chlororaphis]
MIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
MIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 168 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14609.56 Da Isoelectric Point: 4.6017
>AT272865 WP_041988420.1 NZ_CP118149:c2598772-2598371 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQTIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQTIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|