Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 546505..547175 | Replicon | chromosome |
| Accession | NZ_CP118149 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 60037 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A554PKP7 |
| Locus tag | PUP59_RS02445 | Protein ID | WP_041985377.1 |
| Coordinates | 546505..546933 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
| Locus tag | PUP59_RS02450 | Protein ID | WP_009046453.1 |
| Coordinates | 546930..547175 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP59_RS02415 (PUP59_02415) | 541727..542236 | - | 510 | WP_009046447.1 | DUF1097 domain-containing protein | - |
| PUP59_RS02420 (PUP59_02420) | 542270..543010 | - | 741 | WP_016702555.1 | SDR family oxidoreductase | - |
| PUP59_RS02425 (PUP59_02425) | 543140..544030 | + | 891 | WP_041985374.1 | LysR family transcriptional regulator | - |
| PUP59_RS02430 (PUP59_02430) | 544155..544337 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | - |
| PUP59_RS02435 (PUP59_02435) | 544367..544768 | + | 402 | WP_009046450.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PUP59_RS02440 (PUP59_02440) | 545338..546375 | + | 1038 | WP_016702559.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP59_RS02445 (PUP59_02445) | 546505..546933 | - | 429 | WP_041985377.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PUP59_RS02450 (PUP59_02450) | 546930..547175 | - | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
| PUP59_RS02455 (PUP59_02455) | 547315..548154 | - | 840 | WP_009046454.1 | taurine dioxygenase | - |
| PUP59_RS02460 (PUP59_02460) | 548390..549229 | - | 840 | WP_009046455.1 | taurine ABC transporter permease TauC | - |
| PUP59_RS02465 (PUP59_02465) | 549226..550020 | - | 795 | WP_028683844.1 | taurine ABC transporter ATP-binding subunit | - |
| PUP59_RS02470 (PUP59_02470) | 550116..551093 | - | 978 | WP_009046457.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15897.41 Da Isoelectric Point: 5.4927
>T272864 WP_041985377.1 NZ_CP118149:c546933-546505 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYTHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYTHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554PKP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G7DZE9 |