Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HTH_37(antitoxin) |
| Location | 6536480..6537120 | Replicon | chromosome |
| Accession | NZ_CP118148 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 880622 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285GR45 |
| Locus tag | PUP58_RS29665 | Protein ID | WP_028681531.1 |
| Coordinates | 6536480..6536662 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A554PIE8 |
| Locus tag | PUP58_RS29670 | Protein ID | WP_041984783.1 |
| Coordinates | 6536695..6537120 (+) | Length | 142 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP58_RS29635 (PUP58_29635) | 6531799..6532506 | + | 708 | WP_041984770.1 | hypothetical protein | - |
| PUP58_RS29640 (PUP58_29640) | 6532503..6533426 | + | 924 | WP_041984773.1 | hypothetical protein | - |
| PUP58_RS29645 (PUP58_29645) | 6533423..6533971 | + | 549 | WP_041984775.1 | hypothetical protein | - |
| PUP58_RS29650 (PUP58_29650) | 6533968..6534672 | + | 705 | WP_041984777.1 | hypothetical protein | - |
| PUP58_RS29655 (PUP58_29655) | 6534645..6535616 | + | 972 | WP_041984780.1 | hypothetical protein | - |
| PUP58_RS29660 (PUP58_29660) | 6535613..6536254 | - | 642 | WP_041985169.1 | hypothetical protein | - |
| PUP58_RS29665 (PUP58_29665) | 6536480..6536662 | + | 183 | WP_028681531.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP58_RS29670 (PUP58_29670) | 6536695..6537120 | + | 426 | WP_041984783.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP58_RS29675 (PUP58_29675) | 6537297..6537944 | - | 648 | WP_124355757.1 | hypothetical protein | - |
| PUP58_RS29680 (PUP58_29680) | 6538786..6538995 | + | 210 | WP_124355758.1 | hypothetical protein | - |
| PUP58_RS29685 (PUP58_29685) | 6540232..6541035 | + | 804 | WP_274319129.1 | lipopolysaccharide biosynthesis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 6486828..6541035 | 54207 | |
| - | inside | Prophage | - | - | 6507351..6544151 | 36800 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6764.83 Da Isoelectric Point: 10.7304
>T272861 WP_028681531.1 NZ_CP118148:6536480-6536662 [Pseudomonas chlororaphis]
MKYSEFRRWLKAQGAEFQPGKGSHFKVTLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
MKYSEFRRWLKAQGAEFQPGKGSHFKVTLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15470.58 Da Isoelectric Point: 4.4313
>AT272861 WP_041984783.1 NZ_CP118148:6536695-6537120 [Pseudomonas chlororaphis]
MFKYALEIHEEPGTVWLSCEEIPEFHAAGDTVGEALDSVLDALETALSIYVDERRPIPSGNAEAQAGHVLLCLPALTAAK
VALWNAVLDEGTTKAELARRLGIQRPQVDRLLDFLHDSKIENVERALQELGRRISITVEAA
MFKYALEIHEEPGTVWLSCEEIPEFHAAGDTVGEALDSVLDALETALSIYVDERRPIPSGNAEAQAGHVLLCLPALTAAK
VALWNAVLDEGTTKAELARRLGIQRPQVDRLLDFLHDSKIENVERALQELGRRISITVEAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285GR45 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554PIE8 |