Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6360120..6360709 | Replicon | chromosome |
| Accession | NZ_CP118148 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 880622 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A554PHZ9 |
| Locus tag | PUP58_RS28720 | Protein ID | WP_041987451.1 |
| Coordinates | 6360410..6360709 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP58_RS28715 | Protein ID | WP_041987449.1 |
| Coordinates | 6360120..6360413 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP58_RS28695 (PUP58_28695) | 6355661..6356824 | - | 1164 | WP_041987444.1 | acyltransferase | - |
| PUP58_RS28700 (PUP58_28700) | 6357019..6358209 | - | 1191 | WP_041987447.1 | serine hydrolase domain-containing protein | - |
| PUP58_RS28705 (PUP58_28705) | 6358336..6359223 | + | 888 | WP_009051074.1 | LysR family transcriptional regulator | - |
| PUP58_RS28710 (PUP58_28710) | 6359595..6359987 | + | 393 | WP_009051075.1 | hypothetical protein | - |
| PUP58_RS28715 (PUP58_28715) | 6360120..6360413 | - | 294 | WP_041987449.1 | putative addiction module antidote protein | Antitoxin |
| PUP58_RS28720 (PUP58_28720) | 6360410..6360709 | - | 300 | WP_041987451.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP58_RS28725 (PUP58_28725) | 6360880..6361329 | + | 450 | WP_124314409.1 | DUF3828 domain-containing protein | - |
| PUP58_RS28730 (PUP58_28730) | 6361354..6362364 | - | 1011 | WP_173424526.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PUP58_RS28735 (PUP58_28735) | 6362422..6362721 | - | 300 | WP_009051080.1 | helix-turn-helix transcriptional regulator | - |
| PUP58_RS28740 (PUP58_28740) | 6362785..6363876 | - | 1092 | WP_009051081.1 | copper-containing nitrite reductase | - |
| PUP58_RS28745 (PUP58_28745) | 6364102..6364344 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
| PUP58_RS28750 (PUP58_28750) | 6364341..6365228 | + | 888 | WP_009051083.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11231.97 Da Isoelectric Point: 10.6086
>T272860 WP_041987451.1 NZ_CP118148:c6360709-6360410 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|