Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2508677..2509262 | Replicon | chromosome |
Accession | NZ_CP118148 | ||
Organism | Pseudomonas chlororaphis strain NCCB 880622 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A7S5HMS4 |
Locus tag | PUP58_RS11335 | Protein ID | WP_016705075.1 |
Coordinates | 2508969..2509262 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A8A9ZIA4 |
Locus tag | PUP58_RS11330 | Protein ID | WP_009048177.1 |
Coordinates | 2508677..2508967 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP58_RS11320 (PUP58_11320) | 2506189..2507571 | + | 1383 | WP_009048175.1 | efflux transporter outer membrane subunit | - |
PUP58_RS11325 (PUP58_11325) | 2507690..2508277 | + | 588 | WP_028682910.1 | hypothetical protein | - |
PUP58_RS11330 (PUP58_11330) | 2508677..2508967 | - | 291 | WP_009048177.1 | putative addiction module antidote protein | Antitoxin |
PUP58_RS11335 (PUP58_11335) | 2508969..2509262 | - | 294 | WP_016705075.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP58_RS11340 (PUP58_11340) | 2509497..2510891 | - | 1395 | WP_124313189.1 | VOC family protein | - |
PUP58_RS11345 (PUP58_11345) | 2511156..2512280 | + | 1125 | WP_274319337.1 | diguanylate cyclase | - |
PUP58_RS11350 (PUP58_11350) | 2512374..2513618 | + | 1245 | WP_274319338.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP58_RS11355 (PUP58_11355) | 2513857..2514255 | + | 399 | WP_124313192.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10699.27 Da Isoelectric Point: 10.0959
>T272858 WP_016705075.1 NZ_CP118148:c2509262-2508969 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNTLIVLLLGGDK
SSQPADICQARSLAKEF
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNTLIVLLLGGDK
SSQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7S5HMS4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8A9ZIA4 |