Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2486822..2487441 | Replicon | chromosome |
| Accession | NZ_CP118148 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 880622 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PUP58_RS11235 | Protein ID | WP_274319330.1 |
| Coordinates | 2487259..2487441 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP58_RS11230 | Protein ID | WP_103330829.1 |
| Coordinates | 2486822..2487223 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP58_RS11215 (PUP58_11215) | 2482683..2484572 | + | 1890 | WP_274319329.1 | PAS domain S-box protein | - |
| PUP58_RS11220 (PUP58_11220) | 2484569..2485204 | + | 636 | WP_023968669.1 | response regulator transcription factor | - |
| PUP58_RS11225 (PUP58_11225) | 2485298..2486062 | + | 765 | WP_124298953.1 | hypothetical protein | - |
| PUP58_RS11230 (PUP58_11230) | 2486822..2487223 | - | 402 | WP_103330829.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP58_RS11235 (PUP58_11235) | 2487259..2487441 | - | 183 | WP_274319330.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP58_RS11240 (PUP58_11240) | 2487805..2488086 | - | 282 | WP_274319331.1 | hypothetical protein | - |
| PUP58_RS11245 (PUP58_11245) | 2488505..2488861 | - | 357 | WP_124313178.1 | hypothetical protein | - |
| PUP58_RS11250 (PUP58_11250) | 2488846..2489628 | - | 783 | WP_110175430.1 | hypothetical protein | - |
| PUP58_RS11255 (PUP58_11255) | 2489639..2490184 | - | 546 | WP_124313179.1 | PAAR domain-containing protein | - |
| PUP58_RS11260 (PUP58_11260) | 2490385..2491545 | + | 1161 | WP_053275419.1 | IS30 family transposase | - |
| PUP58_RS11265 (PUP58_11265) | 2491816..2492211 | + | 396 | WP_106696970.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2486822..2497044 | 10222 | |
| - | flank | IS/Tn | - | - | 2490385..2491545 | 1160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6776.94 Da Isoelectric Point: 10.9678
>T272857 WP_274319330.1 NZ_CP118148:c2487441-2487259 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKNPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKNPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14565.51 Da Isoelectric Point: 4.5918
>AT272857 WP_103330829.1 NZ_CP118148:c2487223-2486822 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELARDGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELARDGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|