Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 430407..430923 | Replicon | chromosome |
| Accession | NZ_CP118148 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 880622 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A8A9Z863 |
| Locus tag | PUP58_RS01915 | Protein ID | WP_028681510.1 |
| Coordinates | 430642..430923 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A554PKE4 |
| Locus tag | PUP58_RS01910 | Protein ID | WP_009046356.1 |
| Coordinates | 430407..430652 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP58_RS01885 (PUP58_01885) | 426175..427170 | + | 996 | WP_124301006.1 | sulfotransferase family protein | - |
| PUP58_RS01890 (PUP58_01890) | 427136..427894 | - | 759 | WP_009046352.1 | slipin family protein | - |
| PUP58_RS01895 (PUP58_01895) | 427896..429281 | - | 1386 | WP_009046353.1 | nodulation protein NfeD | - |
| PUP58_RS01900 (PUP58_01900) | 429505..429966 | + | 462 | WP_016705004.1 | YbaK/EbsC family protein | - |
| PUP58_RS01905 (PUP58_01905) | 430097..430342 | + | 246 | WP_009046355.1 | DUF2789 domain-containing protein | - |
| PUP58_RS01910 (PUP58_01910) | 430407..430652 | + | 246 | WP_009046356.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUP58_RS01915 (PUP58_01915) | 430642..430923 | + | 282 | WP_028681510.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP58_RS01920 (PUP58_01920) | 431056..431484 | + | 429 | WP_009046358.1 | MarR family transcriptional regulator | - |
| PUP58_RS01925 (PUP58_01925) | 431481..433565 | + | 2085 | WP_274319182.1 | FUSC family protein | - |
| PUP58_RS01930 (PUP58_01930) | 433562..433771 | + | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
| PUP58_RS01935 (PUP58_01935) | 433768..434664 | + | 897 | WP_016705006.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10907.82 Da Isoelectric Point: 10.6258
>T272854 WP_028681510.1 NZ_CP118148:430642-430923 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKRKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKRKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A9Z863 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554PKE4 |