Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6111882..6112471 | Replicon | chromosome |
Accession | NZ_CP118147 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174151 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A285IHJ3 |
Locus tag | PUP56_RS27570 | Protein ID | WP_062824477.1 |
Coordinates | 6112172..6112471 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP56_RS27565 | Protein ID | WP_007924096.1 |
Coordinates | 6111882..6112175 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP56_RS27540 (PUP56_27540) | 6107595..6108053 | + | 459 | WP_009045805.1 | GNAT family N-acetyltransferase | - |
PUP56_RS27545 (PUP56_27545) | 6108307..6108963 | + | 657 | WP_007924093.1 | DedA family protein | - |
PUP56_RS27550 (PUP56_27550) | 6108969..6109778 | + | 810 | WP_062824480.1 | zinc-dependent peptidase | - |
PUP56_RS27555 (PUP56_27555) | 6110043..6110570 | + | 528 | WP_114761534.1 | inorganic diphosphatase | - |
PUP56_RS27560 (PUP56_27560) | 6111385..6111766 | + | 382 | Protein_5431 | DUF3077 domain-containing protein | - |
PUP56_RS27565 (PUP56_27565) | 6111882..6112175 | - | 294 | WP_007924096.1 | putative addiction module antidote protein | Antitoxin |
PUP56_RS27570 (PUP56_27570) | 6112172..6112471 | - | 300 | WP_062824477.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP56_RS27575 (PUP56_27575) | 6112643..6113092 | + | 450 | WP_009045812.1 | DUF3828 domain-containing protein | - |
PUP56_RS27580 (PUP56_27580) | 6113117..6114127 | - | 1011 | WP_205350727.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP56_RS27585 (PUP56_27585) | 6114185..6114484 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
PUP56_RS27590 (PUP56_27590) | 6114552..6115640 | - | 1089 | WP_062824475.1 | copper-containing nitrite reductase | - |
PUP56_RS27595 (PUP56_27595) | 6115866..6116108 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP56_RS27600 (PUP56_27600) | 6116105..6116992 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11261.01 Da Isoelectric Point: 10.8652
>T272853 WP_062824477.1 NZ_CP118147:c6112471-6112172 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|