Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 1232394..1232932 | Replicon | chromosome |
| Accession | NZ_CP118147 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 174151 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PUP56_RS05465 | Protein ID | WP_114760040.1 |
| Coordinates | 1232654..1232932 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PUP56_RS05460 | Protein ID | WP_009042148.1 |
| Coordinates | 1232394..1232657 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP56_RS05445 (PUP56_05445) | 1228384..1230657 | - | 2274 | WP_114760042.1 | TonB-dependent siderophore receptor | - |
| PUP56_RS05450 (PUP56_05450) | 1230863..1231543 | + | 681 | WP_009042146.1 | Fe2+-dependent dioxygenase | - |
| PUP56_RS05455 (PUP56_05455) | 1231547..1232332 | + | 786 | WP_114760041.1 | tetratricopeptide repeat protein | - |
| PUP56_RS05460 (PUP56_05460) | 1232394..1232657 | + | 264 | WP_009042148.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PUP56_RS05465 (PUP56_05465) | 1232654..1232932 | + | 279 | WP_114760040.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP56_RS05470 (PUP56_05470) | 1233007..1234170 | - | 1164 | WP_009042150.1 | type III PLP-dependent enzyme | - |
| PUP56_RS05475 (PUP56_05475) | 1234723..1235880 | - | 1158 | WP_062823682.1 | ABC transporter ATP-binding protein | - |
| PUP56_RS05480 (PUP56_05480) | 1235877..1236530 | - | 654 | WP_007923833.1 | ABC transporter permease | - |
| PUP56_RS05485 (PUP56_05485) | 1236545..1237438 | - | 894 | WP_114760039.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10781.39 Da Isoelectric Point: 9.6923
>T272851 WP_114760040.1 NZ_CP118147:1232654-1232932 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVRGDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVRGDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|