Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 570450..571120 | Replicon | chromosome |
Accession | NZ_CP118147 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174151 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP56_RS02555 | Protein ID | WP_062824000.1 |
Coordinates | 570450..570878 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N8BIH3 |
Locus tag | PUP56_RS02560 | Protein ID | WP_062823999.1 |
Coordinates | 570875..571120 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP56_RS02540 (PUP56_02540) | 565572..567830 | + | 2259 | WP_114760181.1 | TonB-dependent receptor | - |
PUP56_RS02545 (PUP56_02545) | 567877..569202 | + | 1326 | WP_009041689.1 | LLM class flavin-dependent oxidoreductase | - |
PUP56_RS02550 (PUP56_02550) | 569287..570324 | + | 1038 | WP_114760182.1 | L-glyceraldehyde 3-phosphate reductase | - |
PUP56_RS02555 (PUP56_02555) | 570450..570878 | - | 429 | WP_062824000.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PUP56_RS02560 (PUP56_02560) | 570875..571120 | - | 246 | WP_062823999.1 | hypothetical protein | Antitoxin |
PUP56_RS02565 (PUP56_02565) | 571248..572087 | - | 840 | WP_097134161.1 | taurine dioxygenase | - |
PUP56_RS02570 (PUP56_02570) | 572271..573110 | - | 840 | WP_114760183.1 | taurine ABC transporter permease TauC | - |
PUP56_RS02575 (PUP56_02575) | 573107..573901 | - | 795 | WP_114760184.1 | taurine ABC transporter ATP-binding subunit | - |
PUP56_RS02580 (PUP56_02580) | 573997..574974 | - | 978 | WP_009041696.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15811.42 Da Isoelectric Point: 5.4927
>T272849 WP_062824000.1 NZ_CP118147:c570878-570450 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQMLHASALAMFEEDFIDRIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQMLHASALAMFEEDFIDRIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|