Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6112213..6112802 | Replicon | chromosome |
| Accession | NZ_CP118146 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 174152 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A285IHJ3 |
| Locus tag | PUP66_RS27565 | Protein ID | WP_062824477.1 |
| Coordinates | 6112503..6112802 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP66_RS27560 | Protein ID | WP_007924096.1 |
| Coordinates | 6112213..6112506 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP66_RS27535 (PUP66_27535) | 6107926..6108384 | + | 459 | WP_009045805.1 | GNAT family N-acetyltransferase | - |
| PUP66_RS27540 (PUP66_27540) | 6108638..6109294 | + | 657 | WP_007924093.1 | DedA family protein | - |
| PUP66_RS27545 (PUP66_27545) | 6109300..6110109 | + | 810 | WP_062824480.1 | zinc-dependent peptidase | - |
| PUP66_RS27550 (PUP66_27550) | 6110374..6110901 | + | 528 | WP_114761534.1 | inorganic diphosphatase | - |
| PUP66_RS27555 (PUP66_27555) | 6111716..6112097 | + | 382 | Protein_5430 | DUF3077 domain-containing protein | - |
| PUP66_RS27560 (PUP66_27560) | 6112213..6112506 | - | 294 | WP_007924096.1 | putative addiction module antidote protein | Antitoxin |
| PUP66_RS27565 (PUP66_27565) | 6112503..6112802 | - | 300 | WP_062824477.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP66_RS27570 (PUP66_27570) | 6112974..6113423 | + | 450 | WP_009045812.1 | DUF3828 domain-containing protein | - |
| PUP66_RS27575 (PUP66_27575) | 6113448..6114458 | - | 1011 | WP_205350727.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PUP66_RS27580 (PUP66_27580) | 6114516..6114815 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
| PUP66_RS27585 (PUP66_27585) | 6114883..6115971 | - | 1089 | WP_062824475.1 | copper-containing nitrite reductase | - |
| PUP66_RS27590 (PUP66_27590) | 6116197..6116439 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
| PUP66_RS27595 (PUP66_27595) | 6116436..6117323 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11261.01 Da Isoelectric Point: 10.8652
>T272846 WP_062824477.1 NZ_CP118146:c6112802-6112503 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|