Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2551468..2552053 | Replicon | chromosome |
| Accession | NZ_CP118146 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 174152 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP66_RS11680 | Protein ID | WP_085530375.1 |
| Coordinates | 2551760..2552053 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A285IMN7 |
| Locus tag | PUP66_RS11675 | Protein ID | WP_009043099.1 |
| Coordinates | 2551468..2551758 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP66_RS11665 (PUP66_11665) | 2548983..2550365 | + | 1383 | WP_114761927.1 | efflux transporter outer membrane subunit | - |
| PUP66_RS11670 (PUP66_11670) | 2550484..2551071 | + | 588 | WP_007923530.1 | hypothetical protein | - |
| PUP66_RS11675 (PUP66_11675) | 2551468..2551758 | - | 291 | WP_009043099.1 | putative addiction module antidote protein | Antitoxin |
| PUP66_RS11680 (PUP66_11680) | 2551760..2552053 | - | 294 | WP_085530375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP66_RS11685 (PUP66_11685) | 2552289..2553683 | - | 1395 | WP_114761928.1 | VOC family protein | - |
| PUP66_RS11690 (PUP66_11690) | 2553948..2555072 | + | 1125 | WP_114761929.1 | diguanylate cyclase | - |
| PUP66_RS11695 (PUP66_11695) | 2555166..2556410 | + | 1245 | WP_114761930.1 | M20/M25/M40 family metallo-hydrolase | - |
| PUP66_RS11700 (PUP66_11700) | 2556643..2557038 | + | 396 | WP_114761931.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10736.34 Da Isoelectric Point: 10.0960
>T272845 WP_085530375.1 NZ_CP118146:c2552053-2551760 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|