Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2551660..2552245 | Replicon | chromosome |
Accession | NZ_CP118145 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17417 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP75_RS11730 | Protein ID | WP_085530375.1 |
Coordinates | 2551952..2552245 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A285IMN7 |
Locus tag | PUP75_RS11725 | Protein ID | WP_009043099.1 |
Coordinates | 2551660..2551950 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP75_RS11715 (PUP75_11715) | 2549175..2550557 | + | 1383 | WP_062822916.1 | efflux transporter outer membrane subunit | - |
PUP75_RS11720 (PUP75_11720) | 2550676..2551263 | + | 588 | WP_007923530.1 | hypothetical protein | - |
PUP75_RS11725 (PUP75_11725) | 2551660..2551950 | - | 291 | WP_009043099.1 | putative addiction module antidote protein | Antitoxin |
PUP75_RS11730 (PUP75_11730) | 2551952..2552245 | - | 294 | WP_085530375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP75_RS11735 (PUP75_11735) | 2552481..2553875 | - | 1395 | WP_274336213.1 | VOC family protein | - |
PUP75_RS11740 (PUP75_11740) | 2554140..2555264 | + | 1125 | WP_274336214.1 | diguanylate cyclase | - |
PUP75_RS11745 (PUP75_11745) | 2555358..2556602 | + | 1245 | WP_274336215.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP75_RS11750 (PUP75_11750) | 2556834..2557229 | + | 396 | WP_114761931.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10736.34 Da Isoelectric Point: 10.0960
>T272839 WP_085530375.1 NZ_CP118145:c2552245-2551952 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|