Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2535136..2535755 | Replicon | chromosome |
Accession | NZ_CP118145 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17417 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A285IZB4 |
Locus tag | PUP75_RS11655 | Protein ID | WP_009043086.1 |
Coordinates | 2535573..2535755 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP75_RS11650 | Protein ID | WP_053278311.1 |
Coordinates | 2535136..2535537 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP75_RS11640 (PUP75_11640) | 2532971..2533621 | - | 651 | WP_274336207.1 | hypothetical protein | - |
PUP75_RS11645 (PUP75_11645) | 2533919..2534683 | + | 765 | WP_097140360.1 | hypothetical protein | - |
PUP75_RS11650 (PUP75_11650) | 2535136..2535537 | - | 402 | WP_053278311.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP75_RS11655 (PUP75_11655) | 2535573..2535755 | - | 183 | WP_009043086.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP75_RS11660 (PUP75_11660) | 2536119..2536400 | - | 282 | WP_009043087.1 | hypothetical protein | - |
PUP75_RS11665 (PUP75_11665) | 2536964..2538031 | + | 1068 | WP_114761923.1 | DUF4263 domain-containing protein | - |
PUP75_RS11670 (PUP75_11670) | 2538190..2538738 | - | 549 | WP_274336208.1 | YniB family protein | - |
PUP75_RS11675 (PUP75_11675) | 2538880..2539035 | + | 156 | Protein_2294 | TonB-dependent receptor | - |
PUP75_RS11680 (PUP75_11680) | 2539221..2539874 | + | 654 | WP_085530371.1 | peroxiredoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6800.02 Da Isoelectric Point: 11.0738
>T272838 WP_009043086.1 NZ_CP118145:c2535755-2535573 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14591.59 Da Isoelectric Point: 4.6017
>AT272838 WP_053278311.1 NZ_CP118145:c2535537-2535136 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|