Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1771265..1771887 | Replicon | chromosome |
| Accession | NZ_CP118145 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 17417 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285HEJ8 |
| Locus tag | PUP75_RS08025 | Protein ID | WP_053259927.1 |
| Coordinates | 1771705..1771887 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP75_RS08020 | Protein ID | WP_092418007.1 |
| Coordinates | 1771265..1771672 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP75_RS08000 (PUP75_08000) | 1766440..1767102 | - | 663 | WP_274335951.1 | NAD(P)-binding domain-containing protein | - |
| PUP75_RS08005 (PUP75_08005) | 1767205..1768095 | + | 891 | WP_274336673.1 | LysR family transcriptional regulator | - |
| PUP75_RS08010 (PUP75_08010) | 1768333..1770111 | + | 1779 | WP_274335952.1 | GGDEF and EAL domain-containing protein | - |
| PUP75_RS08015 (PUP75_08015) | 1770145..1771059 | - | 915 | WP_274335953.1 | SGNH/GDSL hydrolase family protein | - |
| PUP75_RS08020 (PUP75_08020) | 1771265..1771672 | - | 408 | WP_092418007.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP75_RS08025 (PUP75_08025) | 1771705..1771887 | - | 183 | WP_053259927.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP75_RS08035 (PUP75_08035) | 1772609..1773493 | - | 885 | WP_009042569.1 | alpha/beta hydrolase | - |
| PUP75_RS08040 (PUP75_08040) | 1773845..1774537 | - | 693 | WP_062823358.1 | 16S rRNA pseudouridine(516) synthase | - |
| PUP75_RS08045 (PUP75_08045) | 1774571..1774789 | - | 219 | WP_274336674.1 | cysteine-rich CWC family protein | - |
| PUP75_RS08050 (PUP75_08050) | 1774797..1776284 | - | 1488 | WP_274335954.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6873.18 Da Isoelectric Point: 11.1084
>T272837 WP_053259927.1 NZ_CP118145:c1771887-1771705 [Pseudomonas chlororaphis]
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14671.69 Da Isoelectric Point: 4.5911
>AT272837 WP_092418007.1 NZ_CP118145:c1771672-1771265 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLSRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLSRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|