Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1215087..1215625 | Replicon | chromosome |
Accession | NZ_CP118145 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17417 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A285H8D2 |
Locus tag | PUP75_RS05380 | Protein ID | WP_009042149.1 |
Coordinates | 1215347..1215625 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP75_RS05375 | Protein ID | WP_009042148.1 |
Coordinates | 1215087..1215350 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP75_RS05360 (PUP75_05360) | 1211076..1213349 | - | 2274 | WP_009042145.1 | TonB-dependent siderophore receptor | - |
PUP75_RS05365 (PUP75_05365) | 1213557..1214237 | + | 681 | WP_009042146.1 | Fe2+-dependent dioxygenase | - |
PUP75_RS05370 (PUP75_05370) | 1214241..1215026 | + | 786 | WP_274335806.1 | tetratricopeptide repeat protein | - |
PUP75_RS05375 (PUP75_05375) | 1215087..1215350 | + | 264 | WP_009042148.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PUP75_RS05380 (PUP75_05380) | 1215347..1215625 | + | 279 | WP_009042149.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP75_RS05385 (PUP75_05385) | 1215700..1216863 | - | 1164 | WP_009042150.1 | type III PLP-dependent enzyme | - |
PUP75_RS05390 (PUP75_05390) | 1217401..1218558 | - | 1158 | WP_274335807.1 | ABC transporter ATP-binding protein | - |
PUP75_RS05395 (PUP75_05395) | 1218555..1219208 | - | 654 | WP_007923833.1 | ABC transporter permease | - |
PUP75_RS05400 (PUP75_05400) | 1219223..1220116 | - | 894 | WP_274335808.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10853.45 Da Isoelectric Point: 8.5409
>T272836 WP_009042149.1 NZ_CP118145:1215347-1215625 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|