Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 429911..430427 | Replicon | chromosome |
Accession | NZ_CP118145 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17417 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A285EY61 |
Locus tag | PUP75_RS01920 | Protein ID | WP_009041601.1 |
Coordinates | 430146..430427 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A285F0M2 |
Locus tag | PUP75_RS01915 | Protein ID | WP_062824057.1 |
Coordinates | 429911..430156 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP75_RS01890 (PUP75_01890) | 425528..426529 | + | 1002 | WP_274335567.1 | sulfotransferase family protein | - |
PUP75_RS01895 (PUP75_01895) | 426495..427253 | - | 759 | WP_007932057.1 | slipin family protein | - |
PUP75_RS01900 (PUP75_01900) | 427255..428640 | - | 1386 | WP_274335568.1 | nodulation protein NfeD | - |
PUP75_RS01905 (PUP75_01905) | 428864..429325 | + | 462 | WP_062824058.1 | YbaK/EbsC family protein | - |
PUP75_RS01910 (PUP75_01910) | 429603..429848 | + | 246 | WP_009041599.1 | DUF2789 domain-containing protein | - |
PUP75_RS01915 (PUP75_01915) | 429911..430156 | + | 246 | WP_062824057.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUP75_RS01920 (PUP75_01920) | 430146..430427 | + | 282 | WP_009041601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP75_RS01925 (PUP75_01925) | 430559..430987 | + | 429 | WP_085533251.1 | MarR family transcriptional regulator | - |
PUP75_RS01930 (PUP75_01930) | 430984..433068 | + | 2085 | WP_274335569.1 | FUSC family protein | - |
PUP75_RS01935 (PUP75_01935) | 433065..433274 | + | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
PUP75_RS01940 (PUP75_01940) | 433271..434167 | + | 897 | WP_274335570.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10879.81 Da Isoelectric Point: 10.5797
>T272833 WP_009041601.1 NZ_CP118145:430146-430427 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285EY61 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285F0M2 |