Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6351716..6352305 | Replicon | chromosome |
Accession | NZ_CP118144 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174181 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A285IHJ3 |
Locus tag | PUP51_RS28715 | Protein ID | WP_062824477.1 |
Coordinates | 6352006..6352305 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP51_RS28710 | Protein ID | WP_007924096.1 |
Coordinates | 6351716..6352009 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP51_RS28685 (PUP51_28685) | 6347452..6347910 | + | 459 | WP_009045805.1 | GNAT family N-acetyltransferase | - |
PUP51_RS28690 (PUP51_28690) | 6348160..6348816 | + | 657 | WP_007924093.1 | DedA family protein | - |
PUP51_RS28695 (PUP51_28695) | 6348822..6349631 | + | 810 | WP_062824480.1 | zinc-dependent peptidase | - |
PUP51_RS28700 (PUP51_28700) | 6349896..6350423 | + | 528 | WP_062824479.1 | inorganic diphosphatase | - |
PUP51_RS28705 (PUP51_28705) | 6351208..6351600 | + | 393 | WP_274330603.1 | hypothetical protein | - |
PUP51_RS28710 (PUP51_28710) | 6351716..6352009 | - | 294 | WP_007924096.1 | putative addiction module antidote protein | Antitoxin |
PUP51_RS28715 (PUP51_28715) | 6352006..6352305 | - | 300 | WP_062824477.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP51_RS28720 (PUP51_28720) | 6352477..6352926 | + | 450 | WP_009045812.1 | DUF3828 domain-containing protein | - |
PUP51_RS28725 (PUP51_28725) | 6352951..6353961 | - | 1011 | WP_274333800.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP51_RS28730 (PUP51_28730) | 6354019..6354318 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
PUP51_RS28735 (PUP51_28735) | 6354386..6355474 | - | 1089 | WP_274330605.1 | copper-containing nitrite reductase | - |
PUP51_RS28740 (PUP51_28740) | 6355700..6355942 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP51_RS28745 (PUP51_28745) | 6355939..6356826 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11261.01 Da Isoelectric Point: 10.8652
>T272832 WP_062824477.1 NZ_CP118144:c6352305-6352006 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|