Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1221652..1222190 | Replicon | chromosome |
Accession | NZ_CP118144 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174181 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PUP51_RS05375 | Protein ID | WP_123362588.1 |
Coordinates | 1221912..1222190 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP51_RS05370 | Protein ID | WP_274331764.1 |
Coordinates | 1221652..1221915 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP51_RS05355 (PUP51_05355) | 1217643..1219916 | - | 2274 | WP_274331761.1 | TonB-dependent siderophore receptor | - |
PUP51_RS05360 (PUP51_05360) | 1220122..1220802 | + | 681 | WP_009042146.1 | Fe2+-dependent dioxygenase | - |
PUP51_RS05365 (PUP51_05365) | 1220806..1221591 | + | 786 | WP_274331763.1 | tetratricopeptide repeat protein | - |
PUP51_RS05370 (PUP51_05370) | 1221652..1221915 | + | 264 | WP_274331764.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PUP51_RS05375 (PUP51_05375) | 1221912..1222190 | + | 279 | WP_123362588.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP51_RS05380 (PUP51_05380) | 1222265..1223428 | - | 1164 | WP_007923836.1 | type III PLP-dependent enzyme | - |
PUP51_RS05385 (PUP51_05385) | 1224129..1225286 | - | 1158 | WP_274331765.1 | ABC transporter ATP-binding protein | - |
PUP51_RS05390 (PUP51_05390) | 1225283..1225936 | - | 654 | WP_007923833.1 | ABC transporter permease | - |
PUP51_RS05395 (PUP51_05395) | 1225951..1226844 | - | 894 | WP_274331766.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10874.52 Da Isoelectric Point: 8.5619
>T272829 WP_123362588.1 NZ_CP118144:1221912-1222190 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVHSLTQAPDTLLINPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVHSLTQAPDTLLINPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|