Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 439756..440272 | Replicon | chromosome |
Accession | NZ_CP118144 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174181 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PUP51_RS01935 | Protein ID | WP_274331216.1 |
Coordinates | 439991..440272 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A285F0M2 |
Locus tag | PUP51_RS01930 | Protein ID | WP_062824057.1 |
Coordinates | 439756..440001 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP51_RS01905 (PUP51_01905) | 435510..436514 | + | 1005 | WP_274331212.1 | sulfotransferase family protein | - |
PUP51_RS01910 (PUP51_01910) | 436480..437238 | - | 759 | WP_007932057.1 | slipin family protein | - |
PUP51_RS01915 (PUP51_01915) | 437240..438625 | - | 1386 | WP_274331214.1 | nodulation protein NfeD | - |
PUP51_RS01920 (PUP51_01920) | 438849..439310 | + | 462 | WP_062824058.1 | YbaK/EbsC family protein | - |
PUP51_RS01925 (PUP51_01925) | 439448..439693 | + | 246 | WP_009041599.1 | DUF2789 domain-containing protein | - |
PUP51_RS01930 (PUP51_01930) | 439756..440001 | + | 246 | WP_062824057.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUP51_RS01935 (PUP51_01935) | 439991..440272 | + | 282 | WP_274331216.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP51_RS01940 (PUP51_01940) | 440404..440832 | + | 429 | WP_085533251.1 | MarR family transcriptional regulator | - |
PUP51_RS01945 (PUP51_01945) | 440829..442913 | + | 2085 | WP_274331218.1 | FUSC family protein | - |
PUP51_RS01950 (PUP51_01950) | 442910..443119 | + | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
PUP51_RS01955 (PUP51_01955) | 443116..444012 | + | 897 | WP_274301765.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10927.80 Da Isoelectric Point: 10.4588
>T272825 WP_274331216.1 NZ_CP118144:439991-440272 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVSADALHGMADCYKIKLKASDYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVSADALHGMADCYKIKLKASDYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|