Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2598920..2599505 | Replicon | chromosome |
Accession | NZ_CP118143 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174182 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP62_RS11840 | Protein ID | WP_062822913.1 |
Coordinates | 2599212..2599505 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A285IMN7 |
Locus tag | PUP62_RS11835 | Protein ID | WP_009043099.1 |
Coordinates | 2598920..2599210 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP62_RS11825 (PUP62_11825) | 2596435..2597817 | + | 1383 | WP_274332749.1 | efflux transporter outer membrane subunit | - |
PUP62_RS11830 (PUP62_11830) | 2597936..2598523 | + | 588 | WP_274332750.1 | hypothetical protein | - |
PUP62_RS11835 (PUP62_11835) | 2598920..2599210 | - | 291 | WP_009043099.1 | putative addiction module antidote protein | Antitoxin |
PUP62_RS11840 (PUP62_11840) | 2599212..2599505 | - | 294 | WP_062822913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP62_RS11845 (PUP62_11845) | 2599741..2601135 | - | 1395 | WP_123361693.1 | VOC family protein | - |
PUP62_RS11850 (PUP62_11850) | 2601400..2602524 | + | 1125 | WP_274332755.1 | diguanylate cyclase | - |
PUP62_RS11855 (PUP62_11855) | 2602618..2603862 | + | 1245 | WP_274332757.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP62_RS11860 (PUP62_11860) | 2604094..2604489 | + | 396 | WP_274332759.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10743.39 Da Isoelectric Point: 10.0959
>T272823 WP_062822913.1 NZ_CP118143:c2599505-2599212 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNMGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|