Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 559537..560207 | Replicon | chromosome |
Accession | NZ_CP118143 | ||
Organism | Pseudomonas chlororaphis strain ATCC 174182 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP62_RS02490 | Protein ID | WP_062824000.1 |
Coordinates | 559537..559965 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N8BIH3 |
Locus tag | PUP62_RS02495 | Protein ID | WP_062823999.1 |
Coordinates | 559962..560207 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP62_RS02475 (PUP62_02475) | 554659..556917 | + | 2259 | WP_274331319.1 | TonB-dependent receptor | - |
PUP62_RS02480 (PUP62_02480) | 556964..558289 | + | 1326 | WP_274331320.1 | LLM class flavin-dependent oxidoreductase | - |
PUP62_RS02485 (PUP62_02485) | 558374..559411 | + | 1038 | WP_274331322.1 | L-glyceraldehyde 3-phosphate reductase | - |
PUP62_RS02490 (PUP62_02490) | 559537..559965 | - | 429 | WP_062824000.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PUP62_RS02495 (PUP62_02495) | 559962..560207 | - | 246 | WP_062823999.1 | hypothetical protein | Antitoxin |
PUP62_RS02500 (PUP62_02500) | 560335..561174 | - | 840 | WP_274301720.1 | taurine dioxygenase | - |
PUP62_RS02505 (PUP62_02505) | 561370..562209 | - | 840 | WP_085533374.1 | taurine ABC transporter permease TauC | - |
PUP62_RS02510 (PUP62_02510) | 562206..563000 | - | 795 | WP_085533376.1 | taurine ABC transporter ATP-binding subunit | - |
PUP62_RS02515 (PUP62_02515) | 563095..564072 | - | 978 | WP_274331324.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15811.42 Da Isoelectric Point: 5.4927
>T272819 WP_062824000.1 NZ_CP118143:c559965-559537 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQMLHASALAMFEEDFIDRIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQMLHASALAMFEEDFIDRIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|